DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Cela2a

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:286 Identity:92/286 - (32%)
Similarity:134/286 - (46%) Gaps:43/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISC----LDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGA 63
            |.|:|  |..||.| ::||    .::.|.: .|:.||:.|..|.:|:||.|........:..||.
  Rat     2 IRTLL--LSALVAG-ALSCGYPTYEVQHDV-SRVVGGQEASPNSWPWQVSLQYLSSGKWHHTCGG 62

  Fly    64 SLISDRYLLTAAHCVEKAVAITYYLG---------GVLRLAPRQLIRSTNPEVHLHPDWNCQSLE 119
            ||:::.::||||||:..:......||         |.|.:...:|:        :|..||.|.|.
  Rat    63 SLVANNWVLTAAHCISNSRTYRVLLGRHSLSTSESGSLAVQVSKLV--------VHEKWNAQKLS 119

  Fly   120 --NDIALVRLPEDALLCDSIRPIRLPGLSS-SRNSYDYVPAIASGWGRMNDESTAISDNLRYVYR 181
              ||||||:|.....|...|:...||...: ..|:|   |...:||||:.... |..|.|:....
  Rat   120 NGNDIALVKLASPVALTSKIQTACLPPAGTILPNNY---PCYVTGWGRLQTNG-ATPDVLQQGRL 180

  Fly   182 FVESNEDCEYSY---ANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILI-GVTSYGKKS 242
            .|.....|..:.   :::|...:|....|..|:|.|||||||  :....|....: |:.|:|...
  Rat   181 LVVDYATCSSASWWGSSVKTNMVCAGGDGVTSSCNGDSGGPL--NCQASNGQWQVHGIVSFGSTL 243

  Fly   243 GCTKGY---PSVFTRITAYLDWIGEV 265
            ||  .|   ||||||::.|:|||..|
  Rat   244 GC--NYPRKPSVFTRVSNYIDWINSV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/249 (32%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 79/249 (32%)
Tryp_SPc 31..267 CDD:238113 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.