DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Cela1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:280 Identity:84/280 - (30%)
Similarity:124/280 - (44%) Gaps:43/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYL 71
            |||..:::.|.|..  |... ...|:.||..||.|.:|.|:.|........|..||.:||...::
  Rat     5 LVFASLVLYGHSTQ--DFPE-TNARVVGGAEARRNSWPSQISLQYLSGGSWYHTCGGTLIRRNWV 66

  Fly    72 LTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPE-------VHLHPDWNCQSLE--NDIALVRL 127
            :||||||...:.....:|      ...|.::...|       :.:||:||..::.  .||||:||
  Rat    67 MTAAHCVSSQMTFRVVVG------DHNLSQNDGTEQYVSVQKIVVHPNWNSNNVAAGYDIALLRL 125

  Fly   128 PEDALLCDSIRPIRLP--GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC- 189
            .:...|.:.::...||  |...:.|:    |...:||||..... .:|..|:..|........| 
  Rat   126 AQSVTLNNYVQLAVLPQEGTILANNN----PCYITGWGRTRTNG-QLSQTLQQAYLPSVDYSICS 185

  Fly   190 --EYSYANIKPTNICMDTTGGKSTCTGDSGGPL------VYSDPVQNADILIGVTSYGKKSGC-T 245
              .|..:.:|.|.:|....|.:|.|.|||||||      .||        :.||||:....|| .
  Rat   186 SSSYWGSTVKTTMVCAGGDGVRSGCQGDSGGPLHCLVNGQYS--------VHGVTSFVSSMGCNV 242

  Fly   246 KGYPSVFTRITAYLDWIGEV 265
            ...|:||||::||:.|:..|
  Rat   243 SRKPTVFTRVSAYISWMNNV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 76/251 (30%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 76/250 (30%)
Tryp_SPc 27..262 CDD:238113 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.