DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Ctrb1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:252 Identity:78/252 - (30%)
Similarity:126/252 - (50%) Gaps:42/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEK----AVAITYYLGG- 90
            ||..||.|....:|:||.|   :....:.:||.||||:.:::|||||..|    .||..:..|. 
  Rat    33 RIVNGEDAIPGSWPWQVSL---QDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSD 94

  Fly    91 -----VLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRN 150
                 ||::|          :|..:|.:|..::.|||.|::|...|...:::..:.||.:..   
  Rat    95 EENIQVLKIA----------QVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVCLPNVDD--- 146

  Fly   151 SYDYVP---AIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTG--GKS 210
              |:.|   ...:|||:....:....:.|:.....:.|..||:.|:.: |.|:: |...|  |.|
  Rat   147 --DFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGS-KITDV-MTCAGASGVS 207

  Fly   211 TCTGDSGGPLV-YSDPVQNADILIGVTSYGKKSG-CTKGYPSVFTRITAYLDWIGEV 265
            :|.|||||||| ..|.|..   |.|:.|:|  || |:...|:|::|:||.:.|:.::
  Rat   208 SCMGDSGGPLVCQKDGVWT---LAGIVSWG--SGVCSTSTPAVYSRVTALMPWVQQI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/247 (31%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 77/247 (31%)
Tryp_SPc 34..259 CDD:238113 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.