DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Cela3a

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:289 Identity:89/289 - (30%)
Similarity:132/289 - (45%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67
            :|::|  |:.|..|    |....|....|:..||.|..:.:|:||.|..|.....:..||.|||:
Mouse     5 LSSLL--LVALASG----CGQPSHNPSSRVVNGEEAVPHSWPWQVSLQYEMGGSFHHTCGGSLIT 63

  Fly    68 DRYLLTAAHCVEKAVAITYYLG----GVLRLAPRQLIRSTNPEVHLHPDWN--CQSLENDIALVR 126
            ..::|||.||:...:.....||    || .....|:|.....|:.:||.||  |.:..|:||||:
Mouse    64 PDWVLTAGHCIMPYLNYRVVLGEHEHGV-EEGSEQVIPINAGELFVHPKWNSECVNCGNNIALVK 127

  Fly   127 LPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC-- 189
            |...|.|.|:::...||  .:.....:..|...|||||::... .:...|:.....|...|.|  
Mouse   128 LSRSAQLGDAVQLACLP--PAGEILPNGAPCYISGWGRLSTNG-PLPTKLQQALLPVVDYEHCSR 189

  Fly   190 -EYSYANIKPTNICMDTTGG----------------KSTCTGDSGGPLVYSDPVQNADILI-GVT 236
             ::....:|.|.:|   .||                .|...|||||||  :.|..|....: |:.
Mouse   190 WDWWGHYVKRTMVC---AGGYIQAHSLSSDTHQPRLLSPLQGDSGGPL--NCPADNGTWQVHGIA 249

  Fly   237 SYGKKSGC-TKGYPSVFTRITAYLDWIGE 264
            |:...||| |...|::|||::|::|||.|
Mouse   250 SFVSPSGCNTLKKPTMFTRVSAFIDWIEE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/257 (31%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 79/257 (31%)
Tryp_SPc 28..279 CDD:238113 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.