DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk7

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:278 Identity:75/278 - (26%)
Similarity:119/278 - (42%) Gaps:44/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASL 65
            :.:.|:|:.|.:...|:           |.||..|...:....|:||.|.  :.|.::  ||..|
Mouse     6 LSLITVLLSLALETAGQ-----------GERIIDGYKCKEGSHPWQVALL--KGNQLH--CGGVL 55

  Fly    66 ISDRYLLTAAHCVEKAVAITYYLGG-VLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPE 129
            :...::||||||  |.......||. .:.....|.|::|  :...||.::.::..|||.||||.|
Mouse    56 VDKYWVLTAAHC--KMGQYQVQLGSDKIGDQSAQKIKAT--KSFRHPGYSTKTHVNDIMLVRLDE 116

  Fly   130 DALLCDSIRPIRL------PGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNED 188
            ...:...:..::|      ||.|.:          .||||...........:|......:.|:.:
Mouse   117 PVKMSSKVEAVQLPEHCEPPGTSCT----------VSGWGTTTSPDVTFPSDLMCSDVKLISSRE 171

  Fly   189 CEYSYAN-IKPTNICMDTTGGK-STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSV 251
            |:..|.: :..|.:|......| :||.||||||||.:|.:|      |:.|:|.........|.|
Mouse   172 CKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQ------GLVSWGTYPCGQPNDPGV 230

  Fly   252 FTRITAYLDWIGEVSGVH 269
            :|::..|..|:.|....|
Mouse   231 YTQVCKYKRWVMETMKTH 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/239 (28%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 67/239 (28%)
Serine protease. /evidence=ECO:0000250 26..246 68/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.