DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Tmprss11d

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:245 Identity:78/245 - (31%)
Similarity:129/245 - (52%) Gaps:19/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLG--GVLR 93
            ||.||..|....:|:||.|.:   |::: .||.:|||:.::||||||.:......|:..  ||..
Mouse   185 RIIGGMQAEPGDWPWQVSLQL---NNVH-HCGGALISNMWVLTAAHCFKSYPNPQYWTATFGVST 245

  Fly    94 LAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI 158
            ::||..:|..  .:..|..::..:.:||||:|:|........:|..:.||  ::::|......|.
Mouse   246 MSPRLRVRVR--AILAHDGYSSVTRDNDIAVVQLDRSVAFSRNIHRVCLP--AATQNIIPGSVAY 306

  Fly   159 ASGWGRMNDESTAISDNLRYVYRFVESNEDCE----YSYANIKPTNICMD-TTGGKSTCTGDSGG 218
            .:|||.:.....|:: |||.....:.|:|:|.    || .::.|..:|.. .:|....|.|||||
Mouse   307 VTGWGSLTYGGNAVT-NLRQGEVRIISSEECNTPAGYS-GSVLPGMLCAGMRSGAVDACQGDSGG 369

  Fly   219 PLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGV 268
            |||..|. :....::|:.|:|.:.| ....|.|:||:|||.:||.:.:|:
Mouse   370 PLVQEDS-RRLWFVVGIVSWGYQCG-LPNKPGVYTRVTAYRNWIRQQTGI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/237 (32%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 75/237 (32%)
Tryp_SPc 186..414 CDD:238113 76/239 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.