DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Tmprss7

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_766043.3 Gene:Tmprss7 / 208171 MGIID:2686594 Length:829 Species:Mus musculus


Alignment Length:249 Identity:75/249 - (30%)
Similarity:119/249 - (47%) Gaps:35/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHC-----VEKAVAITYYLGG 90
            ||.||..::...:|:||.|.....    .:||||:||..:||:||||     :......|.:||.
Mouse   591 RIVGGSDSQEGTWPWQVSLHFVGS----AYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGM 651

  Fly    91 VLR-----LAP-RQLIRSTNPEVHLHPDWNCQSLENDIALVRL----PEDALLCDSIRPIRLPGL 145
            .::     ::| |:::        :|..:|.|:.:.||||::|    ||  .|...|:||.:|..
Mouse   652 YVQGNAKFISPVRRIV--------VHEYYNSQTFDYDIALLQLSIAWPE--TLKQLIQPICIPPA 706

  Fly   146 SSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKS 210
            .....|.:  ....:||||.::..:..|..|:.....:.....|..:|..|....:|.....|||
Mouse   707 GQKVRSGE--KCWVTGWGRRHEADSKGSPVLQQAEVELIDQTVCVSTYGIITSRMLCAGVMSGKS 769

  Fly   211 -TCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWI 262
             .|.|||||||..........||.|:.|:|  .||.: .:|.|:||:::::.||
Mouse   770 DACKGDSGGPLSCRRKSDGKWILTGIVSWG--HGCGRPNFPGVYTRVSSFVPWI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/247 (30%)
Tmprss7NP_766043.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..52
SEA 94..194 CDD:366610
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060
Tryp_SPc 591..821 CDD:214473 73/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.