DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and PRSS55

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:249 Identity:73/249 - (29%)
Similarity:115/249 - (46%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSI-EEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVL-- 92
            ||.||..|...:||:||.:.. .||     :||.|:::..::||||||:.........|..||  
Human    67 RITGGMEAEVGEFPWQVSIQARSEP-----FCGGSILNKWWILTAAHCLYSEELFPEELSVVLGT 126

  Fly    93 --RLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL---PGLSSSRNSY 152
              ..:|...|:.. ..:.||.|:...:::|||||:.|.....|.|...||.|   ||.::.|..:
Human   127 NDLTSPSMEIKEV-ASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWRECW 190

  Fly   153 DYVPAIASGWGRMN-DESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKS----TC 212
                  .:|||:.| .:..::..:|......:...|:|...:..:....:|   .|.|:    .|
Human   191 ------VAGWGQTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKLTKNMLC---AGYKNESYDAC 246

  Fly   213 TGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVS 266
            .||||||||.:.........:|:.|:||..| .|..|.::|.:..|..||.:|:
Human   247 KGDSGGPLVCTPEPGEKWYQVGIISWGKSCG-EKNTPGIYTSLVNYNLWIEKVT 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/243 (29%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 70/243 (29%)
Tryp_SPc 68..298 CDD:238113 71/245 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.