DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and St14

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:117/264 - (44%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITY--------Y 87
            |:.||..|...::|:||.|.......:   |||||||..:|::||||.:......|        :
Mouse   634 RVVGGTNADEGEWPWQVSLHALGQGHL---CGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAF 695

  Fly    88 LG----------GVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL 142
            ||          ||..|..:::|        .||.:|..:.:.||||:.|.:.......:|||.|
Mouse   696 LGLLDQSKRSASGVQELKLKRII--------THPSFNDFTFDYDIALLELEKSVEYSTVVRPICL 752

  Fly   143 PGLSSSRNSYDYVPAI-ASGWGRMNDESTAI----SDNLRYVYRFVESNEDCE-YSYANIKPTNI 201
            |   .:.:.:....|| .:|||...:..|..    ...:|.:     :...|| .....|.|..:
Mouse   753 P---DATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVI-----NQTTCEDLMPQQITPRMM 809

  Fly   202 CMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWIGE 264
            |:. .:||..:|.|||||||..::. .......||.|:|:  ||. :..|.|:||:....|||.|
Mouse   810 CVGFLSGGVDSCQGDSGGPLSSAEK-DGRMFQAGVVSWGE--GCAQRNKPGVYTRLPVVRDWIKE 871

  Fly   265 VSGV 268
            .:||
Mouse   872 HTGV 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/256 (29%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 74/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.