DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and try-6

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001361988.1 Gene:try-6 / 185959 WormBaseID:WBGene00006624 Length:343 Species:Caenorhabditis elegans


Alignment Length:319 Identity:68/319 - (21%)
Similarity:113/319 - (35%) Gaps:101/319 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STILVFLLILVQGRSISC-------LDMGHGIGGRIAGGELARANQFPYQVGL-------SIEEP 54
            |.:.:.|::.|..|.::.       .|.|..:..:|..|..|..::.|:.|.:       :|:| 
 Worm     6 SIVTICLIVFVDSRKLTAEENEKRLEDCGKNVKSKIFNGRKAEIDEAPWAVRINTYTNVKNIDE- 69

  Fly    55 NDMYCW---CGASLISDRYLLTAAHCVEKAVAITY----YLGGVLR------------------- 93
                .|   |..:|.|.|::|||.||     |.||    :.|.|:.                   
 Worm    70 ----TWSKHCSGTLTSPRHILTATHC-----AATYTETEWNGTVIDAPIYRKYCEEQSTLIVREV 125

  Fly    94 LAPRQLIRSTN-PEV----HLH--------PDWNCQSLE--NDIALVRLPEDALLCDSIRPIRLP 143
            .|.|.::|..| .|:    :|.        .|.|...::  :||.::.|.||......::|:.:.
 Worm   126 AASRIVVRLRNRTEIGRAKYLFMFNYCRKIVDKNAYEIQYPDDIMIIELSEDVEYSSELKPVCVA 190

  Fly   144 GLSSSRNSYDYVP---AIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMD- 204
            |     |:.|..|   ....|:|  :|.......:|:.::.....:...|....|.:.|:..|| 
 Worm   191 G-----NTDDNAPNSHLDLFGFG--DDPPRDKPSSLKNLHDIPLKHHKVEIMDMNKEGTSKRMDP 248

  Fly   205 -------TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRIT 256
                   .|.....|.||||..              ||....|::...    .|||:.|
 Worm   249 RLFIAKSVTRTSVACPGDSGAG--------------GVKEIDKRTTVV----GVFTKTT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 62/285 (22%)
try-6NP_001361988.1 DUF316 7..320 CDD:367641 67/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.