DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and try-4

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:299 Identity:72/299 - (24%)
Similarity:113/299 - (37%) Gaps:93/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAH------------CVEK---------- 80
            ::...||:.|..:::..|.:    |.|:||..:::||||            |..|          
 Worm    53 SKIKNFPWAVSFTVDGVNRL----GGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIY 113

  Fly    81 --------AVAITYYLGGVL------------RLAPRQLIRSTNPEVHLHPDW---NCQSLENDI 122
                    ...:.|  ||..            |.....:|.:....|.:..::   ||.. .:|.
 Worm   114 RSIKFLRDTRKVAY--GGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLK-GHDW 175

  Fly   123 ALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIA-SGWGRMNDESTAISDNLRYVYRFVES- 185
            |:|.:.:.....:::|||.||     |.:..|..::| .||||.              |.|.|| 
 Worm   176 AIVEVEKRIHFSENVRPICLP-----RPNMYYTKSLAVPGWGRS--------------YIFNESG 221

  Fly   186 ----------NEDCEYSYANIKPTN----IC-----MDTTGGKSTCTGDSGGPLVYSDPVQNADI 231
                      :.||:..:::..|.:    ||     :.......||.|||||.|.|.|.......
 Worm   222 PLIHEIPMRIDRDCKRPWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAF 286

  Fly   232 LIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270
            ||.:||:|.: ||.....:.|||:..||:.|...:||.|
 Worm   287 LIAITSFGTR-GCPSNMLARFTRVDMYLNLICNYTGVCY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/289 (24%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 69/291 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.