DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and try-10

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:243 Identity:64/243 - (26%)
Similarity:95/243 - (39%) Gaps:66/243 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CGASLISDRYLLTAAHCV----EKAVAITYYLGGVLRLAPRQLIRSTNPEVHL--HPD------- 112
            ||..||:...::|:||||    :.||.....||                :|||  |.|       
 Worm   104 CGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLG----------------DVHLNKHDDGEQEFRS 152

  Fly   113 ---------WNCQSLEN-DIALVRLPEDALLCDSIRPIRLPGLSS--SRNSYDYVP--------- 156
                     :|..|..| |:|::.||:.|.:|.|...:::..|.|  |.|..:..|         
 Worm   153 HAMAISKKFFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETS 217

  Fly   157 -AIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPL 220
             ...:|||:..:::...||::|.:...:......:..|.      |....||....|.||||.| 
 Worm   218 VCYVAGWGKTENKTAKYSDSVRQMMVNLSVRRIGKRKYL------IAKAVTGSSRACMGDSGSP- 275

  Fly   221 VYSDPVQNADILIGVTSY-GKKSGCTKGYPS---VFTRITAYL---DW 261
            ||.. |....||:|..:: |..|..::..||   .|.|...|.   ||
 Worm   276 VYCF-VNGKRILVGTVAHIGSFSKMSEQDPSNHISFCRDFEYTFVSDW 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 64/243 (26%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 55/209 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.