DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and try-8

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_504916.1 Gene:try-8 / 179134 WormBaseID:WBGene00017791 Length:401 Species:Caenorhabditis elegans


Alignment Length:284 Identity:54/284 - (19%)
Similarity:98/284 - (34%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHC----VEKAVAITYYLGGV 91
            ::..|.:|.|.:.|:.|.|.|.:..|...:...:|:|:|::::....    ....:.:.:.|..|
 Worm    49 KVLNGTIANAGETPWTVALYIPDHLDHSVYTTGTLVSNRHIISYDRLFLTNTTDGIKLRHNLKAV 113

  Fly    92 LR----------LAPRQLIRSTNPEVHL--------HPDWNCQSLE-----------NDIALVRL 127
            :.          |.|..|:||....:.|        |...:.:|:.           |.:|::.|
 Worm   114 IEKDMECEGNDYLLPSDLVRSVAVFLDLLSVERQSGHEQLDVKSVRILNGCVKSFQFNRVAVIEL 178

  Fly   128 PEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNE-DCEY 191
            .:......:.|||...........|.:.     |:|   |...|:.|   ...|..:..| .|::
 Worm   179 KKPVHKGQNARPICFGSDFRIYTGYKFF-----GYG---DNRGAVKD---ATLRHTKIKEVPCKH 232

  Fly   192 SYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYG---------KKSGCTKG 247
                  |:......|.....|.||.||..|       :.....|.:||         .|:.....
 Worm   233 ------PSEDLFCVTAENPLCNGDFGGAAV-------SKFHGSVRAYGVYVDGPYECNKANRRTV 284

  Fly   248 YPSVFTRITAYLDWIGEVSGVHYP 271
            |  .|..:|...:.:.:|:|:..|
 Worm   285 Y--TFANMTKLAESLCDVTGICAP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 51/273 (19%)
try-8NP_504916.1 DUF316 11..304 CDD:367641 53/280 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.