DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and F25E5.4

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001379698.1 Gene:F25E5.4 / 179133 WormBaseID:WBGene00017785 Length:425 Species:Caenorhabditis elegans


Alignment Length:325 Identity:74/325 - (22%)
Similarity:116/325 - (35%) Gaps:86/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGRSISCLDMGH--------GIGG---RIAGGELARANQFPYQVGLSIE-- 52
            |::|  |:.|.||........||..|        ||.|   ....|:.||....|:.|.:.::  
 Worm     1 MKVS--LLVLTILFTAVCAGKLDEKHNEILQLKCGIKGSQREFINGDTARPGDHPWAVSVYVKAN 63

  Fly    53 --EPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHL------ 109
              ..|.::...| :|||.|::||.     .::.:   :.|..|:..::.:.......|.      
 Worm    64 TTSKNGVFLGPG-TLISARHVLTF-----NSIKV---VDGKRRILGQEEVNGACNGNHFELSQDE 119

  Fly   110 --HPDWNCQ---------SLENDIALVRL--------PEDALLCDSIRPIRLPGLSSSRNSYDYV 155
              |.|::.:         ..:|.||.|.:        |...||...::.      |:..|...| 
 Worm   120 MYHFDYDFEHFKNFDSKRDFKNTIASVYIINGCQSSPPPATLLMFELKE------SALHNKKGY- 177

  Fly   156 PAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTT---------GGKST 211
            |...|...:..|.|......|....|.|..      ::|   ||| |..|.         ..:..
 Worm   178 PVCISNSPKHFDASDFEVFGLNQQGRLVSG------AFA---PTN-CTATAPFSCAHAVKQNQGL 232

  Fly   212 CTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSV-----FTRITAYLDWIGEVSGVHYP 271
            |:||.||..|  ..:.|...::|..:.|.|: | |..|..     |..|..|.:.|.||:|:..|
 Worm   233 CSGDFGGSAV--SRIDNRFTMLGFFAQGNKN-C-KAKPETLEAFKFLNIGYYREEICEVTGICTP 293

  Fly   272  271
             Worm   294  293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 57/273 (21%)
F25E5.4NP_001379698.1 DUF316 5..291 CDD:367641 71/315 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.