DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk1b27

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_064664.1 Gene:Klk1b27 / 16619 MGIID:891980 Length:263 Species:Mus musculus


Alignment Length:271 Identity:81/271 - (29%)
Similarity:126/271 - (46%) Gaps:38/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAA 75
            |||....|:..:|....:..||.||...:.|..|:.|.:.   .::.|. ||..|:...::||||
Mouse     4 LILFLALSLGGIDAAPPVQSRIIGGFKCKKNSQPWHVAVL---RSNKYI-CGGVLLDPNWVLTAA 64

  Fly    76 HCVEKAVAITYYLGGVLRL------APRQLIRSTNPEVHLHPDWNCQSL----------ENDIAL 124
            ||.....:......|..:|      |..:.:..:.|    |||:|...|          .||:.|
Mouse    65 HCYGNDTSQHNVWLGKNKLFQREPSAQHRWVSKSFP----HPDYNMSLLNDHIPHPEDKSNDLML 125

  Fly   125 VRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC 189
            :||.:.|.:.|:::||.||.......|    ..:|||||.:......|.::|:.|:..:..||:|
Mouse   126 LRLSKPADITDAVKPIDLPTEEPKLGS----TCLASGWGSITPTKYQIPNDLQCVFIKLLPNENC 186

  Fly   190 EYSYANIKPTNICM---DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSV 251
            ..:|.: |.|::.:   :|.|||.||.|||||||:..      .:|.|:||:|.........|.|
Mouse   187 AKAYVH-KVTDVMLCVGETGGGKGTCKGDSGGPLICD------GVLHGITSWGSIPCAKPNAPGV 244

  Fly   252 FTRITAYLDWI 262
            ||::..:..||
Mouse   245 FTKLIKFTSWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/249 (30%)
Klk1b27NP_064664.1 Tryp_SPc 24..255 CDD:214473 74/249 (30%)
Tryp_SPc 25..258 CDD:238113 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.