DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk1b24

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:274 Identity:79/274 - (28%)
Similarity:126/274 - (45%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLL 72
            ::.|||....|:..:|....:..|:.||.....|..|:.|.:.   ..:.|. ||..|::..::|
Mouse     1 MWFLILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAVF---RYNKYI-CGGVLLNPNWVL 61

  Fly    73 TAAHCVEKAVAITYYLGGVLRL------APRQLIRSTNPEVHLHPDWNCQSL----------END 121
            |||||...|.:......|..:|      |..:.:..:.|    |||:|...|          .||
Mouse    62 TAAHCYGNATSQYNVWLGKNKLFQREPSAQHRWVSKSFP----HPDYNMSLLNDDIPQPKDKSND 122

  Fly   122 IALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESN 186
            :.|:||.|.|.:.|:::||.||.......|    ..:|||||.:........::|:.|:..:..|
Mouse   123 LMLLRLSEPADITDAVKPIDLPTEEPKLGS----TCLASGWGSITPTKWQKPNDLQCVFIKLLPN 183

  Fly   187 EDCEYSYANIKPTNICM---DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGY 248
            |:|...|.: |.|::.:   :..|||.||.|||||||:..      .||.|:||:|.........
Mouse   184 ENCTKPYLH-KVTDVMLCAGEMGGGKDTCAGDSGGPLICD------GILHGITSWGPVPCGKPNA 241

  Fly   249 PSVFTRITAYLDWI 262
            |:::|::..:..||
Mouse   242 PAIYTKLIKFASWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/249 (29%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 72/249 (29%)
Tryp_SPc 25..258 CDD:238113 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.