DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk1b16

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_032480.1 Gene:Klk1b16 / 16615 MGIID:891982 Length:261 Species:Mus musculus


Alignment Length:272 Identity:71/272 - (26%)
Similarity:117/272 - (43%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLL 72
            ::.|||....|:..:|....:..||.||.....|..|:||.:...:.:    .||..|:...::|
Mouse     1 MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWQVAVYYHKEH----ICGGVLLDRNWVL 61

  Fly    73 TAAHCVEKAVAITYYLGGVLRLAP---RQLIRSTNPEVHLHPDWNCQSL-----------ENDIA 123
            |||||......:......:.:..|   .:|:..:.|    ||.:|...|           .||:.
Mouse    62 TAAHCYVDECEVWLGKNQLFQEEPSAQNRLVSKSFP----HPGFNMTLLTFEKLPPGADFSNDLM 122

  Fly   124 LVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNED 188
            |:||.:.|.:.|.::||.||......:|    ..:.||||.:........|:|:.::..:..||:
Mouse   123 LLRLSKPADITDVVKPIDLPTKEPKLDS----TCLVSGWGSITPTKWQKPDDLQCMFTKLLPNEN 183

  Fly   189 CEYSYANIKPTNICMDTT---GGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPS 250
            |..:|. :|.|::.:.|.   ..|..|.|||||||:..      .:|.|..|.|.......|..:
Mouse   184 CAKAYL-LKVTDVMLCTIEMGEDKGPCVGDSGGPLICD------GVLQGTVSIGPDPCGIPGVSA 241

  Fly   251 VFTRITAYLDWI 262
            ::|.:..:..||
Mouse   242 IYTNLVKFNSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 64/247 (26%)
Klk1b16NP_032480.1 Tryp_SPc 25..256 CDD:238113 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.