DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CTRB1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001897.4 Gene:CTRB1 / 1504 HGNCID:2521 Length:263 Species:Homo sapiens


Alignment Length:276 Identity:77/276 - (27%)
Similarity:127/276 - (46%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ISCLDM-----GHGIG---------GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDR 69
            :||..:     |.|:.         .||..||.|....:|:||.|   :....:.:||.||||:.
Human     7 LSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSL---QDKTGFHFCGGSLISED 68

  Fly    70 YLLTAAHC----VEKAVAITYYLGG------VLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIAL 124
            :::|||||    .:..||..:..|.      ||::|          :|..:|.::..::.|||.|
Human    69 WVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIA----------KVFKNPKFSILTVNNDITL 123

  Fly   125 VRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA----IASGWGRMNDESTAISDNLRYVYRFVES 185
            ::|...|....::..:.||      ::.|..||    ..:|||:....:....|.|:.....:.|
Human   124 LKLATPARFSQTVSAVCLP------SADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLS 182

  Fly   186 NEDCEYSYA-NIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYP 249
            |.:|:.|:. .|....||...: |.|:|.||||||||...  ..|..|:|:.|:|..: |:...|
Human   183 NAECKKSWGRRITDVMICAGAS-GVSSCMGDSGGPLVCQK--DGAWTLVGIVSWGSDT-CSTSSP 243

  Fly   250 SVFTRITAYLDWIGEV 265
            .|:.|:|..:.|:.::
Human   244 GVYARVTKLIPWVQKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/245 (29%)
CTRB1NP_001897.4 Tryp_SPc 33..256 CDD:214473 72/245 (29%)
Tryp_SPc 34..259 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.