DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG43742

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:275 Identity:92/275 - (33%)
Similarity:137/275 - (49%) Gaps:38/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILVQGRSISCLDMG--HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67
            ::|:..:::.|......||..  ..|..|:|.|..|..:||...:      .|:...:||.|||.
  Fly     6 SLLLVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQFMAAL------YNNSEFFCGGSLIH 64

  Fly    68 DRYLLTAAHCVEKAVAITYYLGGVLRLAP----RQLIRSTNPEVHLHPDWNCQSLENDIALVRLP 128
            .:|:|||||||.....:|.:||...|..|    :.::| .|.:|.|||:::.....|||||:||.
  Fly    65 KQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLR-LNAKVILHPNFHGNIFLNDIALLRLE 128

  Fly   129 EDALLCDSIRPIRL----PGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYV--YRFVESNE 187
            .:.:....||||.:    ...|:::|::     .|.|||:  .|...|||.|.::  .|..:|  
  Fly   129 REVIFEAHIRPICIILDEDVTSNNQNNF-----TAYGWGK--TEHGNISDVLSFIDLVRLPKS-- 184

  Fly   188 DCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLV--YSDPVQNADILIGVTSYGKKSGCTKGYPS 250
               ..|.||  ..||..:|.| .||..||||||:  :....::.|||.|:|||| .:.|: |...
  Fly   185 ---MCYQNI--NTICAGSTSG-DTCESDSGGPLIGNFVHRGKSRDILFGITSYG-DAECS-GLFG 241

  Fly   251 VFTRITAYLDWIGEV 265
            |:|.:.||..||..|
  Fly   242 VYTDVNAYKSWIASV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 84/242 (35%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 84/242 (35%)
Tryp_SPc 35..256 CDD:238113 85/244 (35%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.