DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk1b9

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:281 Identity:83/281 - (29%)
Similarity:121/281 - (43%) Gaps:60/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAA 75
            |||....|:..:|....:..||.||.....|..|:.|  ::...|:..  ||..|:...::||||
Mouse     4 LILFLALSLGGIDAAPPVHSRIVGGFKCEKNSQPWHV--AVYRYNEYI--CGGVLLDANWVLTAA 64

  Fly    76 HCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVH-------LHPDWNCQSL------------END 121
            ||        ||....:.|....|........|       |||.:| :||            .||
Mouse    65 HC--------YYEENKVSLGKNNLYEEEPSAQHRLVSKSFLHPGYN-RSLHRNHIRHPEYDYSND 120

  Fly   122 IALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESN 186
            :.|:||.:.|.:.|.::||.||.......|    ..:|||||.........:.:|:.|...:..|
Mouse   121 LMLLRLSKPADITDVVKPIALPTEEPKLGS----TCLASGWGSTTPFKFQNAKDLQCVNLKLLPN 181

  Fly   187 EDCEYSYANIKPTNICM---DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYG-------KK 241
            |||..::.. |.|::.:   :|.|||.||.|||||||:..      .:|.|:||:|       ||
Mouse   182 EDCGKAHIE-KVTDVMLCAGETDGGKDTCKGDSGGPLICD------GVLQGITSWGFTPCGEPKK 239

  Fly   242 SGCTKGYPSVFTRITAYLDWI 262
                   |.|:|::..:..||
Mouse   240 -------PGVYTKLIKFTSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 76/259 (29%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 76/259 (29%)
Tryp_SPc 25..256 CDD:238113 77/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.