DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Klk1b22

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:269 Identity:82/269 - (30%)
Similarity:124/269 - (46%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAA 75
            |||....|:..:|....:..||.||.....|..|:||.:..   .|.|. ||..|:...::||||
Mouse     4 LILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYY---LDEYL-CGGVLLDRNWVLTAA 64

  Fly    76 HCVEKAVAITYYLGGVLRL-----APRQLIRSTNPEVHLHPDWNCQ---------SLENDIALVR 126
            ||.|....|  :||.....     |..:|:..:.|    |||:|..         .|.||:.|:|
Mouse    65 HCYEDKYNI--WLGKNKLFQDEPSAQHRLVSKSFP----HPDFNMSLLQSVPTGADLSNDLMLLR 123

  Fly   127 LPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEY 191
            |.:.|.:.|.::||.||.......|    ..:|||||.:|.......::|:.|...:..||.|..
Mouse   124 LSKPADITDVVKPIDLPTTEPKLGS----TCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVK 184

  Fly   192 SYANIKPTNICM---DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFT 253
            ::. :|.|::.:   :..|||.||.|||||||:..      .:|.|:||:|.........|:::|
Mouse   185 AHI-LKVTDVMLCAGEMNGGKDTCKGDSGGPLICD------GVLQGITSWGSTPCGEPNAPAIYT 242

  Fly   254 RITAYLDWI 262
            ::..:..||
Mouse   243 KLIKFTSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/247 (30%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 75/247 (30%)
Tryp_SPc 25..254 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.