DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Ctsg

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_031826.1 Gene:Ctsg / 13035 MGIID:88563 Length:261 Species:Mus musculus


Alignment Length:263 Identity:86/263 - (32%)
Similarity:133/263 - (50%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRY 70
            :|:...||:||..          .|:|.||..||.:.:||...|.|:.|..:.. ||..|:.:.:
Mouse     5 LLLLTFILLQGDE----------AGKIIGGREARPHSYPYMAFLLIQSPEGLSA-CGGFLVREDF 58

  Fly    71 LLTAAHCVEKAVAITYYLGG---VLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDAL 132
            :||||||:..::.:|  ||.   .:|...:|||  |......|||:|.|::.|||.|::|...|.
Mouse    59 VLTAAHCLGSSINVT--LGAHNIQMRERTQQLI--TVLRAIRHPDYNPQNIRNDIMLLQLRRRAR 119

  Fly   133 LCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC--EYSYAN 195
            ...|::|:.||..|......|.  ...:||||::....  ::.|:.|...|:.::.|  .:.:.|
Mouse   120 RSGSVKPVALPQASKKLQPGDL--CTVAGWGRVSQSRG--TNVLQEVQLRVQMDQMCANRFQFYN 180

  Fly   196 IKPTNICM-DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYL 259
             ..|.||: :....||...||||||||.|:..|      |:.|||..:|   ..|:|||:|.:::
Mouse   181 -SQTQICVGNPRERKSAFRGDSGGPLVCSNVAQ------GIVSYGSNNG---NPPAVFTKIQSFM 235

  Fly   260 DWI 262
            .||
Mouse   236 PWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/236 (33%)
CtsgNP_031826.1 Tryp_SPc 20..238 CDD:214473 78/236 (33%)
Tryp_SPc 21..241 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.