DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP001198

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_321961.2 Gene:AgaP_AGAP001198 / 1281971 VectorBaseID:AGAP001198 Length:260 Species:Anopheles gambiae


Alignment Length:264 Identity:76/264 - (28%)
Similarity:126/264 - (47%) Gaps:22/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYC--WCGASLISDR 69
            |.|::|      .:.:.:||.|...|..|..|..::|||||.|.....|....  :|..|:|:.|
Mosquito     4 LAFIII------PALIALGHSIRPPIIEGTEANLHEFPYQVSLQWNFNNGSRARHFCSGSIINQR 62

  Fly    70 YLLTAAHCVEKAVAITYY--LGGVLRLAPRQ--LIRSTNPEVHLHPDWNCQSLENDIALVRLPED 130
            ::||||||:|:.....::  :.||..:|..:  ..|........|..::..::..||.:::|...
Mosquito    63 WILTAAHCLEEYTKDGWFEVVAGVNNIAHEEAGAQRRNVTRYEQHESYDLSAIRYDIGVLQLSHP 127

  Fly   131 ALLCDSIRPIRLPGLSSSRNSYDYVP-AIASGWGRMNDESTAI-SDNLRYVYRFVESNEDCEYSY 193
            ..|..:|:.:||    :::::..:.. |..:|||.::.....| .|.|..|...:.:.|||: :.
Mosquito   128 LDLTRNIKTMRL----ATKDTLIHQKIAKFAGWGSISKTWEDIYPDKLMKVNLILRTEEDCQ-TI 187

  Fly   194 ANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAY 258
            ..|..|.||.......|.||.||||||..:  :....:.|||.|||:|. |....|.|::.:..:
Mosquito   188 GKIDETQICAGGYKNVSGCTADSGGPLTVT--IDGEQMQIGVLSYGEKP-CQARLPIVYSSVMYF 249

  Fly   259 LDWI 262
            .|||
Mosquito   250 HDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/238 (29%)
AgaP_AGAP001198XP_321961.2 Tryp_SPc 23..255 CDD:238113 70/239 (29%)
Tryp_SPc 23..253 CDD:214473 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.