DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP001241

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_321913.5 Gene:AgaP_AGAP001241 / 1281929 VectorBaseID:AGAP001241 Length:267 Species:Anopheles gambiae


Alignment Length:256 Identity:66/256 - (25%)
Similarity:95/256 - (37%) Gaps:76/256 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVE---------------- 79
            ||.||........||||.|.... |.:   ||.|:||..::||||||::                
Mosquito    42 RIVGGSKTTIESVPYQVSLRYFN-NHI---CGGSIISHSWVLTAAHCLDWYPHNDEITVRTGSTS 102

  Fly    80 -----KAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRP 139
                 ...|:.||                    |||..::....:.|:|.||             
Mosquito   103 QSAGGSLHAVFYY--------------------HLHERYDPNEFQWDVATVR------------- 134

  Fly   140 IRLP-GLSSSR------NSYDYVPA---IASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYA 194
            :|.| ||.:.|      .|.::...   :.:|||.:. .:..::|.|:.:.......|.|..::.
Mosquito   135 VRTPMGLGAGRAPIPLATSTEWTVGERILVTGWGYLT-AAGKVNDTLQMILLDAVPQESCNRTWT 198

  Fly   195 NIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRI 255
            .....::......|...|.||||||.| .|.||     .|:.|:| ...|..|.|.|||.|
Mosquito   199 GFITADMLCAGGPGVDACAGDSGGPAV-QDGVQ-----YGIVSWG-SIDCGNGLPGVFTNI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 66/256 (26%)
AgaP_AGAP001241XP_321913.5 Tryp_SPc 42..261 CDD:214473 66/256 (26%)
Tryp_SPc 43..264 CDD:238113 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.