DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:270 Identity:85/270 - (31%)
Similarity:122/270 - (45%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            ||.||..:...|..|...|:....:    :||||:::||:||||.|||...|      ..:||..
Mosquito    11 RIVGGVNSNRGQITYIASLTKRGGH----FCGASIVNDRWLLTAGHCVCSGV------NKILRAN 65

  Fly    96 PRQLI-----RS--------TNP------EVHL-----HPDWNCQSLENDIALVRLPEDALLCDS 136
            ..|.:     ||        ::|      ||.:     ||.:.|....|||||:.|........|
Mosquito    66 QIQAVLGLYRRSEFGGNQIDSDPFSDRAYEVGIRTIVPHPGYVCNKPSNDIALLELARRIDFSAS 130

  Fly   137 IRPIRLPGLSSSRNSYDYVPAIASGWG------RMNDESTAISDNLRYVYRFVESNEDCEYSY-- 193
            :|||.|...:......:...|:.:|||      .:.|::..:...:..|:|    ||:||..|  
Mosquito   131 VRPICLSSGADGSARVEGQTAVVAGWGWQQENRNLGDKADTLQRAVVDVFR----NEECESMYRR 191

  Fly   194 ----ANIKPTNICMDT-TGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVF 252
                ..|..|.:|... |||...|..|||||||.||     ::|||:.|.|  .||.: |:|.::
Mosquito   192 GNRSRTIARTQLCAGKGTGGVDACWADSGGPLVTSD-----NVLIGIVSTG--IGCARPGFPGIY 249

  Fly   253 TRITAYLDWI 262
            ||::.|..||
Mosquito   250 TRVSEYASWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 83/268 (31%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 83/268 (31%)
Tryp_SPc 12..259 CDD:238113 82/267 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.