DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CLIPD3

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_321698.4 Gene:CLIPD3 / 1281744 VectorBaseID:AGAP001433 Length:670 Species:Anopheles gambiae


Alignment Length:261 Identity:86/261 - (32%)
Similarity:115/261 - (44%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV----EKAVAITYYLGG 90
            |||.||..|...|:|:...:.:........|||.|||..:|:||||||.    ::..|...:   
Mosquito   423 GRIVGGIEAPTGQWPWMAAIFLHGTKRTEFWCGGSLIGTKYILTAAHCTRDSRQRPFAARQF--- 484

  Fly    91 VLRLAPRQLIRSTNP---------EVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPG-- 144
            .:||....|.....|         ||..||.::.....|||||:.|.:.......:.|:.|||  
Mosquito   485 TVRLGDIDLSTDGEPSAPVTYKVTEVRAHPRFSRVGFYNDIALLVLDKPVRKSKYVIPVCLPGPN 549

  Fly   145 ------LSSSRNSYDYVPAIASGWGRM---NDESTAISDNLRYVYRFVESNEDCEYSYAN-IKPT 199
                  |:..|       |...|||..   ..|||........|:|    ||||..:|.. |...
Mosquito   550 LPSKERLAGRR-------ATVVGWGTTYYGGKESTKQQQATLPVWR----NEDCNRAYFQPITDN 603

  Fly   200 NICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIG 263
            .:|.. :.||...|.|||||||:..  |:.....:||.|:|.|.| ..|||.|:|||:.|::||.
Mosquito   604 FVCAGFSEGGVDACQGDSGGPLMML--VEARWTQVGVVSFGNKCG-EPGYPGVYTRISEYMEWIR 665

  Fly   264 E 264
            |
Mosquito   666 E 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/256 (32%)
CLIPD3XP_321698.4 CLIP 292..335 CDD:197829
Tryp_SPc 424..664 CDD:214473 82/256 (32%)
Tryp_SPc 425..667 CDD:238113 84/259 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.