DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP001707

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_321381.5 Gene:AgaP_AGAP001707 / 1281466 VectorBaseID:AGAP001707 Length:511 Species:Anopheles gambiae


Alignment Length:252 Identity:56/252 - (22%)
Similarity:95/252 - (37%) Gaps:45/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IEEPNDMYCW----------------CGASLISDRYLLTAAHCVEKAVA-------ITYYLG--G 90
            |..|...:.|                ||:::|.:|:|:|||||:..::.       :|...|  .
Mosquito   264 IRSPKGQFPWAAPIFDTGVPAKPKYICGSTIIGERHLVTAAHCMYDSIGNPRSANDLTTVPGMHN 328

  Fly    91 VLRLAPRQLIRSTNPEVHLHPDWNCQS---LENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSY 152
            :.......|...:..::.:|.|:..:.   |:.|||::.:.:.....:.:|||.|...|.:....
Mosquito   329 IDNFFDADLQERSVKKIFIHEDYYFEDSILLDTDIAVMLIDQPLTYNNLVRPICLWQESDNLEQI 393

  Fly   153 DYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTN---ICMDTTGGKSTCTG 214
            .......||||...|.:.....   ||...|.....|..:...:...|   .|.| ..|...|||
Mosquito   394 VGQKGFVSGWGVTEDGNAKYPS---YVTATVVDRRTCTRNLERLIAGNARIFCAD-GHGSVPCTG 454

  Fly   215 DSGGPLVYSDPVQNAD--ILIGVTSYGKKS----GCTKGYPSVFTRITAYLDWIGEV 265
            |||..||    ::...  .:.|:.|.|:..    .|.:....::|.|..:..|:..|
Mosquito   455 DSGSGLV----IKRGSRYYIRGIVSVGQYDPNTLTCARDKYVLYTDIAPFRYWLSRV 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 54/247 (22%)
AgaP_AGAP001707XP_321381.5 GD_N 50..150 CDD:292649
Tryp_SPc 261..507 CDD:238113 55/250 (22%)
Tryp_SPc 261..503 CDD:214473 54/246 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.