DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP001798

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_321263.5 Gene:AgaP_AGAP001798 / 1281317 VectorBaseID:AGAP001798 Length:664 Species:Anopheles gambiae


Alignment Length:291 Identity:70/291 - (24%)
Similarity:106/291 - (36%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQVGL----------SIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITY 86
            |.||......:.|:.:.:          .:..|:..|. ||.|::::|.::|||||......  :
Mosquito   388 IIGGRNVSIAEVPWHMAIYKNLHDDTLDDLRSPDWQYV-CGGSILTERLVVTAAHCFWATEG--F 449

  Fly    87 YLGGVLRLA--------------PRQLIRSTNPEVHLH-----PDWNCQS--LENDIALVRLPED 130
            :.....|||              |.|..       |:|     |.:...|  ...|||:|.|...
Mosquito   450 FDKRFFRLAAGKYRRDIAAIEALPAQYF-------HIHEILTQPQYQDFSGYYNLDIAIVVLNGF 507

  Fly   131 ALLCDSIRPIRLPGLSSSRNSYDYVPAI---ASGWGRMNDESTAISDNLRYVYRFVE-SNED--- 188
            ......||||.|.....:.:.....||.   .:|||     .|..:.||..|.:.:: :..|   
Mosquito   508 ISFRTYIRPICLERNLRTESEKRIRPASVGRVAGWG-----FTTSTGNLSSVLKVIDIATVDYVT 567

  Fly   189 C-EYSYANIKP----TNICMDT-TGGKSTCTGDSGG--PLVYSDPVQNADI--LIGVTSYGKKS- 242
            | |:|....:|    ...|..: ..|.|.|.|||||  .|...:|.....:  |.|:.|...:: 
Mosquito   568 CREFSPVAYRPFLTGDKFCAGSPRTGTSVCQGDSGGGFALGKEEPGGGDTVYYLYGLVSSAPRAA 632

  Fly   243 --GCTKGYPSVFTRITAYLDWIGEVSGVHYP 271
              ||.......||.:..|:..|.:... .||
Mosquito   633 DGGCDNNKYVAFTEVQNYIPMILDAES-RYP 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/280 (24%)
AgaP_AGAP001798XP_321263.5 LDLa 31..62 CDD:238060
LDLa 71..103 CDD:197566
LDLa 121..152 CDD:197566
LDLa 162..194 CDD:238060
CCP 239..304 CDD:153056
Tryp_SPc 388..654 CDD:214473 67/280 (24%)
Tryp_SPc 388..654 CDD:238113 67/280 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.