DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP011669

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_320844.4 Gene:AgaP_AGAP011669 / 1280970 VectorBaseID:AGAP011669 Length:576 Species:Anopheles gambiae


Alignment Length:301 Identity:71/301 - (23%)
Similarity:121/301 - (40%) Gaps:71/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILV-----QGRSISCLDMGHGIGGR-------IAGGELARANQFPYQVGLSIEEPNDM 57
            |:|:.||.:|     |...::|       |.|       |..|..|:|..:|:.|.|...:....
Mosquito     9 TLLLGLLCVVSQTRGQENHLTC-------GKRKVVSQYLIHNGIDAKAGHWPWHVALFHRKDAQY 66

  Fly    58 YCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA------------------PRQLIRSTN 104
            ...||.|::.:..:|||:|||       |...||:.::                  ...|:|   
Mosquito    67 EYACGGSILDENTILTASHCV-------YTQSGVISISRVSVDVGRIHLNESSEYTQTHLVR--- 121

  Fly   105 PEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDES 169
             |:.:||.::..|:.|||||::|..:..:...::|:.|..:.|::...........|:|  .:|.
Mosquito   122 -EIIVHPGFSKNSIVNDIALIKLSSNITMNKYVQPVCLWTMDSNQELIVGRNGTIVGFG--VNEQ 183

  Fly   170 TAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGK-----STCTGDSGGPLVYSDPVQNA 229
            ..:|:.|:.....|.....|......:..|::..|...||     |.|.|||||.:.:       
Mosquito   184 DVVSEQLKQALIGVVDPLSCIADDRGVFGTHLTSDMFCGKGQKGVSACNGDSGGGMFF------- 241

  Fly   230 DI--------LIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            :|        |:..|..|.:. |.....:.:|.:..||:||
Mosquito   242 EIGGKWFVRGLVSFTPLGTEQ-CDSLKNTAYTDVAKYLEWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 61/268 (23%)
AgaP_AGAP011669XP_320844.4 Tryp_SPc 41..282 CDD:238113 62/262 (24%)
Tryp_SPc 43..281 CDD:214473 59/258 (23%)
Tryp_SPc 330..568 CDD:214473
Tryp_SPc 330..568 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.