DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CLIPA5

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_320729.4 Gene:CLIPA5 / 1280861 VectorBaseID:AGAP011787 Length:397 Species:Anopheles gambiae


Alignment Length:268 Identity:75/268 - (27%)
Similarity:119/268 - (44%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HGIGGRIAG---GELARANQFPYQVGLSIEEPND-------MYCWCGASLISDRYLLTAAHCV-- 78
            :|:|..:.|   || :...:||:.|.:.:..|.|       :| .||.|:|:...:|||||||  
Mosquito   122 NGLGFSVTGVKDGE-SHYGEFPWMVAVMLSSPMDNSDSILNVY-QCGGSVIAPNVVLTAAHCVFN 184

  Fly    79 EKAVAITYYLGGVLRLAPRQLIRSTN---PEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPI 140
            :....:....|........:|....|   .||.||..::.:||.||:||:.|.|...|.::::||
Mosquito   185 KPKTQLLLRAGEWDTQTEHELYMHQNRRVAEVILHEAFDNESLANDVALLTLAEPFQLGENVQPI 249

  Fly   141 RLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVE----SNEDCEYSYANIKPTN- 200
            .||   .|..|:||....|||||:   :........:.:.:.||    .:..|:.:..:.:..| 
Mosquito   250 CLP---PSGTSFDYQHCFASGWGK---DQFGKEGKYQVILKKVELPVVPHAKCQETMRSQRVGNW 308

  Fly   201 -------ICMDTTGGKSTCTGDSGGPLVYSDPVQNADIL-IGVTSYGKKSGCTK-GYPSVFTRIT 256
                   :|.....|:..|.||.|.|||...|....... .|:.::|  .||.: |.|.|:..:.
Mosquito   309 FVLDQSFLCAGGVAGQDMCRGDGGSPLVCPIPGSPTHYYQAGIVAWG--LGCGEDGIPGVYGDVA 371

  Fly   257 AYLDWIGE 264
            ...|||.:
Mosquito   372 FLRDWIDQ 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 71/259 (27%)
CLIPA5XP_320729.4 Tryp_SPc 135..380 CDD:238113 71/255 (28%)
Tryp_SPc 135..377 CDD:214473 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.