DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CLIPA1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_320725.2 Gene:CLIPA1 / 1280858 VectorBaseID:AGAP011791 Length:440 Species:Anopheles gambiae


Alignment Length:283 Identity:67/283 - (23%)
Similarity:117/283 - (41%) Gaps:61/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HGIGGRIAGGELARA--NQFPYQVGLSIEEPND--MYCWCGASLISDRYLLTAAHCVEKAVAITY 86
            ||:...|...:.:.:  .::|:.|.:......:  :...||.:||....:||.|.|:....:...
Mosquito   147 HGVIFTIENNQFSESEYGEYPWTVAIFARTKTESALKYLCGGALIDRAAVLTTASCLHPYRSDVS 211

  Fly    87 YLGGVLRLA---------PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL 142
            .|  |:||.         |...|.|....::|||.::..|..||||:|.|.:...|..::..:.|
Mosquito   212 SL--VVRLGEWDMSTVREPIPHIDSEMERIYLHPQYSMTSKVNDIAIVILGDTVELNHTVGVVCL 274

  Fly   143 P--GLSSSRNSYDYVPAIAS-----GWG--------RMNDESTAISDNLRYVYRFVESNEDCEYS 192
            |  |:         ||:..:     |||        |...::......|.::     |:|.|:.:
Mosquito   275 PPAGM---------VPSTGTDVTGVGWGEVPNFVVPRKLPQTILKKAQLHHL-----SHELCQQT 325

  Fly   193 YA-------NIKPTNICMDTTGGKS---TCTGDSGGP-LVYSDPVQNADILIGVTSYGKKSGCTK 246
            ..       .:..:.:|  ||...:   .|.||:|.| ::.:.|......|:|::|:|  ..|.|
Mosquito   326 LRKLMGRRFQLHSSFLC--TTAQDAEMLPCRGDTGSPYMMETVPGSERYYLVGLSSWG--YDCNK 386

  Fly   247 -GYPSVFTRITAYLDWI-GEVSG 267
             ..|:|.|.:..:.||| |.:.|
Mosquito   387 QATPTVLTNVAYHRDWIDGVIKG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 61/270 (23%)
CLIPA1XP_320725.2 Tryp_SPc 159..404 CDD:238113 61/264 (23%)
Tryp_SPc 159..403 CDD:214473 60/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.