DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP011793

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_320722.4 Gene:AgaP_AGAP011793 / 1280855 VectorBaseID:AGAP011793 Length:426 Species:Anopheles gambiae


Alignment Length:271 Identity:71/271 - (26%)
Similarity:119/271 - (43%) Gaps:47/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HGIGGRI---AGGELARANQFPYQVGL-----SIEEPNDMYCWCGASLISDRYLLTAAHCVEKAV 82
            :|:..||   :.|| :...:||:...:     ::::..:.| .||.|||....:|||||||:. :
Mosquito   154 NGVQFRITDDSDGE-SEYGEFPWMAAILEEQKALDQIINTY-MCGGSLIHPSVILTAAHCVQN-I 215

  Fly    83 AITYYLGGVLRLA-----------PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDS 136
            .||..   .:||.           |.|..|..  |:..|..:...:..|::||:.|.:...|.::
Mosquito   216 TITAL---KVRLGEWDTRSWKEPFPHQDRRVV--EIAFHEQFFAPAALNNVALLFLDKPVELMET 275

  Fly   137 IRPIRLPGLSSSRNSYDYVPAIASGWGR--MNDES--TAISDNLRYVYRFVESNEDCEYSYA--- 194
            :..|.||   .:..::|.|..:|||||:  ..:|.  .||   |:.|...:.....|:.:..   
Mosquito   276 VNTICLP---PANYTFDPVRCVASGWGKDVFGNEGMFQAI---LKKVELPLMPRGACQRALRMTR 334

  Fly   195 -----NIKPTNICMDTTGGKSTCTGDSGGPLVYSDP-VQNADILIGVTSYGKKSGCTKGYPSVFT 253
                 .:..:.:|.....|:.||.||.|.|||...| |.|......:.::|...| .:|.|.|:.
Mosquito   335 LGRRFKLHESFLCAGGEKGRDTCKGDGGSPLVCPIPGVANGYYQASIVAWGINCG-IEGVPGVYV 398

  Fly   254 RITAYLDWIGE 264
            .:..:.:||.|
Mosquito   399 NVALFREWIDE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/262 (26%)
AgaP_AGAP011793XP_320722.4 Tryp_SPc 167..410 CDD:238113 67/258 (26%)
Tryp_SPc 167..407 CDD:214473 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.