DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP011794

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_320721.3 Gene:AgaP_AGAP011794 / 1280854 VectorBaseID:AGAP011794 Length:154 Species:Anopheles gambiae


Alignment Length:131 Identity:35/131 - (26%)
Similarity:57/131 - (43%) Gaps:27/131 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 YDYVPAIASGWGR--MNDESTAISDNLRYVYRFVE----SNEDCEYSYANIKPTN---------- 200
            :|.|..:|||||:  ..:|..     |:.:.:.||    ....|:.:   ::.|:          
Mosquito    16 FDPVRCVASGWGKDVFGNEGM-----LQVIMKKVELPLVPRGACQRA---LRTTHLGRQFKLHES 72

  Fly   201 -ICMDTTGGKSTCTGDSGGPLVYSDP-VQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIG 263
             :|.....|:.||.||.|.|||...| |.|.....|:.::|...| .:|.|.|:..:..:.:||.
Mosquito    73 FVCAGGEKGRDTCKGDGGSPLVCPIPGVANGYYQAGIVAWGIDCG-KEGIPGVYVNVALFREWID 136

  Fly   264 E 264
            |
Mosquito   137 E 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 32/127 (25%)
AgaP_AGAP011794XP_320721.3 Tryp_SPc <2..138 CDD:238113 35/131 (27%)
Tryp_SPc <2..135 CDD:214473 32/127 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.