DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP011908

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_320621.4 Gene:AgaP_AGAP011908 / 1280755 VectorBaseID:AGAP011908 Length:391 Species:Anopheles gambiae


Alignment Length:271 Identity:85/271 - (31%)
Similarity:122/271 - (45%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAH 76
            ::||.:...|   |.....:|.||.:|..|::...|||.  :|..:..:|..::||.||:|||||
Mosquito   137 LVVQPQECDC---GWSRTAKIVGGSVAGVNEYTAMVGLL--DPLTVNVFCSGAIISSRYVLTAAH 196

  Fly    77 C---------VEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDAL 132
            |         |:..|....|..|:  ..|...|.:.. ::..|..:|.|:..|||||::...:..
Mosquito   197 CARTIPSVSRVQALVGDHDYRSGL--DTPYSAIYNIE-QIISHEYYNEQTRNNDIALLKTSTEMD 258

  Fly   133 LCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTA----ISDNLRYVYRFVESNEDCEYSY 193
            ....:.||.|| .:.|..|:..:....:|||     :|:    :|..||.....|..|.:|...|
Mosquito   259 FNRGVGPICLP-FTYSTYSFGGLSVDIAGWG-----TTSFGGPMSTILRKTTLNVLQNANCTAPY 317

  Fly   194 ANIKPTNICMDTTGGKSTCTGDSGGPL-------VYSDPVQNADILIGVTSYGKKSGCTKGYPSV 251
            .|  ...||.... |:.:|..||||.|       :||         ||:.|||  |.|....|||
Mosquito   318 VN--DQKICTFAV-GRDSCQYDSGGALFLRGSQRMYS---------IGIISYG--SACAASTPSV 368

  Fly   252 FTRITAYLDWI 262
            .||:||||.||
Mosquito   369 ATRVTAYLSWI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/250 (32%)
AgaP_AGAP011908XP_320621.4 CUB 26..>106 CDD:294042
Tryp_SPc 153..379 CDD:214473 79/250 (32%)
Tryp_SPc 154..382 CDD:238113 81/251 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.