DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP009273

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_320067.4 Gene:AgaP_AGAP009273 / 1280238 VectorBaseID:AGAP009273 Length:308 Species:Anopheles gambiae


Alignment Length:272 Identity:70/272 - (25%)
Similarity:112/272 - (41%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IAGGELARANQFPYQ--VGLSIEEPND----------MYCWCGASLISDRYLLTAAHCVEKAVAI 84
            |.||......:||:.  :|..:||..:          :...||.|||:.|::||||||...|..|
Mosquito    56 IFGGTQVNVTEFPHMAVLGWKVEELGEGADSGDDGAGVRWQCGGSLITLRFVLTAAHCAADANNI 120

  Fly    85 TYYLGGVLRLAPRQLIR-------STNPEVHL----------HPDWNCQSLENDIALVRLPEDAL 132
                       |.:|:|       ||..:.:.          ||:........|:|||.|.....
Mosquito   121 -----------PPRLVRLGDVNLASTKDDAYAQQFDILRIVRHPEHRFSRKYFDLALVELDGVVR 174

  Fly   133 LCDSIRPIRLPGLSSSRNSYDYVPA---IASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY- 193
            |.:.:.|..|  .::|:    .:||   ..:|:|.:.....::...|:......:|.| |..|: 
Mosquito   175 LTEGVCPTCL--WTNSK----VLPAQFFQTAGFGEITLGGGSVPTLLKTALSATDSTE-CSESFK 232

  Fly   194 ------ANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNAD--ILIGVTSYGKKSGCTKGYPS 250
                  ..|:...:|...... .||.|||||||..|....:.:  .|:.:||:|:  ||..|...
Mosquito   233 YTRGLPEGIRHDQVCASMLNA-DTCQGDSGGPLQVSLRSYSTEHPFLVALTSFGR--GCGIGSSG 294

  Fly   251 VFTRITAYLDWI 262
            |:.::.|::.||
Mosquito   295 VYQQVAAHIPWI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/270 (25%)
AgaP_AGAP009273XP_320067.4 Tryp_SPc 56..308 CDD:238113 70/272 (26%)
Tryp_SPc 56..306 CDD:214473 68/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.