DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CLIPB16

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_320055.4 Gene:CLIPB16 / 1280226 VectorBaseID:AGAP009263 Length:406 Species:Anopheles gambiae


Alignment Length:270 Identity:72/270 - (26%)
Similarity:114/270 - (42%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHC-VE 79
            |:||...|..:|:|          |..|..::|....:.......|..|:|:.:.:||:||| :.
Mosquito   144 GKSIVQGDFYNGLG----------AYPFVARIGFKNTKTGTFIFPCSGSIIARQIVLTSAHCALA 198

  Fly    80 KA-------VAITYY-------LGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPED 130
            ||       |.:..|       .|.....||..:..:.: ::.:|||:......:||||:.|...
Mosquito   199 KAESHRLSSVRVGDYDTRTDPDCGSTGFCAPVAINHAVS-QIIVHPDYIEGQYHHDIALLILRTP 262

  Fly   131 ALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYAN 195
            .....:.:||.|............|..|  |||::: .|.|.|..|:.:...:.|.:.|..:||:
Mosquito   263 INYTVAAQPICLHARKQDLTVGRRVQII--GWGKLS-TSAAKSPELQSLEVPLTSWDKCVRAYAS 324

  Fly   196 I----KPTNI---CMDTTG-GKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVF 252
            .    .|.:|   .|...| |:..|.|..|.||:..|..:.|.  ||:.|:|.::......|||:
Mosquito   325 TGALQSPQSIDGEWMCAGGEGRDACHGFGGAPLIIRDQGRYAQ--IGIMSFGAETCGALNMPSVY 387

  Fly   253 TRITAYLDWI 262
            |.|..|..||
Mosquito   388 TSIAHYAPWI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 64/253 (25%)
CLIPB16XP_320055.4 CLIP 88..126 CDD:295450
Tryp_SPc 157..400 CDD:238113 67/257 (26%)
Tryp_SPc 157..397 CDD:214473 65/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.