DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP009220

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_319997.4 Gene:AgaP_AGAP009220 / 1280178 VectorBaseID:AGAP009220 Length:325 Species:Anopheles gambiae


Alignment Length:281 Identity:77/281 - (27%)
Similarity:132/281 - (46%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSISCLDM---GHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV 78
            |.:..||:   |.....:|:.|:.|:..|||:...|..:..:   .:||.:||::||:||||||:
Mosquito    62 RGLELLDLENCGAYTDDKISFGQDAKLFQFPWMALLKSKAGS---FFCGGTLINERYVLTAAHCL 123

  Fly    79 EKAVAITYYLG-------------GVLRLAPRQL--IRSTNPEVHLHPDWNCQSLENDIALVRLP 128
            ......:..||             |....||:.:  .|:.:     |.|::.:...:||.|:||.
Mosquito   124 VNNDVASVRLGEYDLNSTIDCNKHGDCAPAPQDIPVERAIS-----HEDYSARYKLHDIGLIRLA 183

  Fly   129 EDALLCDSIRPIRLPGLSSSRNSYDYVPAIAS--------GWGRMNDESTAISDNLRYVYRFVES 185
            ..|.|.|::.||.||          ..||..:        |||:  .::...::.|::....:.:
Mosquito   184 RRASLNDNVLPICLP----------VTPAFLTKQTIFFVVGWGQ--TQNALFANKLQFTKLDLMA 236

  Fly   186 NEDC------EYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNAD-ILIGVTSYGKKSG 243
            |::|      :..:..|..:.:|...:.....|:||||||| .|..:||:. :..||.|:|.::.
Mosquito   237 NDECLKQLRPKDRFVRISDSQLCAIGSNLSDNCSGDSGGPL-KSISIQNSRYVQYGVVSFGLRTC 300

  Fly   244 CTKGYPSVFTRITAYLDWIGE 264
            ..:..|.|:||:..|:|||.|
Mosquito   301 GKQSAPGVYTRVERYVDWILE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/260 (27%)
AgaP_AGAP009220XP_319997.4 Tryp_SPc 83..319 CDD:214473 69/256 (27%)
Tryp_SPc 83..319 CDD:238113 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.