DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG43110

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:241 Identity:71/241 - (29%)
Similarity:104/241 - (43%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            :|..|..|......|..|:.    |..:..||.::|.:.::||.||| :....:...||......
  Fly    35 KIISGSNASQQSAQYMAGIF----NTTHLLCGGTIIHEDFVLTVAHC-KSTQTLFVRLGAYNINH 94

  Fly    96 PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL---PGLSSSRNSYDYVPA 157
            |...||..  |...||.::..:..||||||:|....:...:|:||.:   ..|......|:    
  Fly    95 PTDQIRVI--ETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIRYYN---- 153

  Fly   158 IASGWGRMNDESTAISDNLRYVYRFVESNEDCE-YSYANIKPTNICMDTTGGKSTCTGDSGGPLV 221
             |.||||..:...  ||.|:.::....:...|. |...:..|..||..|..| .||.|||||||:
  Fly   154 -AFGWGRTRNAEQ--SDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQG-DTCAGDSGGPLI 214

  Fly   222 YSDPVQ--NADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEV 265
            .....|  |.|...|:||||.:.....|   ::|.::.|..||..:
  Fly   215 SKITYQGKNFDTQFGITSYGTRECNGVG---LYTDVSQYSGWIANI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 69/236 (29%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 69/236 (29%)
Tryp_SPc 36..257 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.