DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG43124

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:283 Identity:56/283 - (19%)
Similarity:105/283 - (37%) Gaps:81/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSIS----CLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLI 66
            :|..:|:..||.:.:    |:|            .:.|.|...|...|: |..:|....|..:||
  Fly     8 VLCIVLMFYQGSAQTLEEDCVD------------HMERINGSSYAPWLA-EILSDSKVICAGALI 59

  Fly    67 SDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHL--HPDWNCQSLENDIALVRLPE 129
            ::.|:||||.|.::...:|..||........:..|.|.....:  .|..|    .|::.:.||..
  Fly    60 NNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFRVTKAYFWMTHFPANN----TNNLCIFRLQT 120

  Fly   130 DALLCDSIRPIRLP------GLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNED 188
            :......|||:.:.      ||:::....:..|.:   |        ....|::.::        
  Fly   121 EVEFKTHIRPMCITKSPKSLGLATTFEIINEKPKM---W--------YFCKNIKGLF-------- 166

  Fly   189 CEYSYA------NIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNAD----ILIGVTSYGKKSG 243
            |:|.:.      ..|||                 |.|  :::.:.|..    :..|:.||..   
  Fly   167 CKYVFGENEEKWQSKPT-----------------GSP--WTETISNGPFKGLVRYGILSYRD--- 209

  Fly   244 CTKGYPSVFTRITAYLDWIGEVS 266
             .|.|..|:..:.::::||.::|
  Fly   210 -NKTYDEVYINVMSHINWIAQIS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 47/248 (19%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.