DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP009966

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_319102.4 Gene:AgaP_AGAP009966 / 1279386 VectorBaseID:AGAP009966 Length:288 Species:Anopheles gambiae


Alignment Length:286 Identity:89/286 - (31%)
Similarity:133/286 - (46%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILV-FLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISD 68
            |:|| |.::.|.|.|.|..:..|..|.||.||.......:||||.|.....     :||.|:|..
Mosquito    18 TVLVSFTIVSVVGCSRSAENYDHTNGERIVGGVPVDIRDYPYQVSLRRGRH-----FCGESIIDS 77

  Fly    69 RYLLTAAHCVEKAVAITYYL----------GGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIA 123
            :::||||||.....|...::          |..:|:  |:::.        ||..|..| :.|.:
Mosquito    78 QWILTAAHCTRTINARNLWIHVGSSHVNDGGESVRV--RRILH--------HPKQNSWS-DYDFS 131

  Fly   124 LVRLPEDALLCDSIRPIRLPGLSSSRNS---YDYVPAIASGWGRMN--DESTAISDNLRYVYRFV 183
            |:.|.:...|.:|::||.|...|:|..:   .|......||||..:  |||..:   ||.....:
Mosquito   132 LLHLDQPLNLSESVQPIPLRKPSASEPTGELSDGTLCKVSGWGNTHNPDESALV---LRAATVPL 193

  Fly   184 ESNEDCEYSY---ANIKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC 244
            .:::.|...|   .::..:.||.. ..|||.:|.||||||||....      |.||.|:||  ||
Mosquito   194 TNHQQCSEVYEGIGSVTESMICAGYDEGGKDSCQGDSGGPLVCDGQ------LTGVVSWGK--GC 250

  Fly   245 TK-GYPSVFTRITAYLDWIGEVSGVH 269
            .: |||.|:.:::...:||.:.  ||
Mosquito   251 AEPGYPGVYAKVSTAYEWIEQT--VH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/250 (30%)
AgaP_AGAP009966XP_319102.4 Tryp_SPc 45..269 CDD:214473 75/250 (30%)
Tryp_SPc 46..272 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.