DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP003971

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_318423.5 Gene:AgaP_AGAP003971 / 1278791 VectorBaseID:AGAP003971 Length:263 Species:Anopheles gambiae


Alignment Length:272 Identity:83/272 - (30%)
Similarity:132/272 - (48%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67
            ::.:|.|:.:      .:.|........||||||.|...|||:||.|.    |:...:||.::::
Mosquito    14 VAAVLGFVTV------AAALPQQANFSPRIAGGEDAADGQFPFQVALI----NEGLVYCGGTVVN 68

  Fly    68 DRYLLTAAHCVE-KAVA-ITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPED 130
            .|::||||.|:. ||:: :..::|...||...:.:  |.....:|||:|.|:..|||||||:.|.
Mosquito    69 RRWILTAAACITGKALSDVQLFVGSADRLTGGRNV--TAERFVIHPDFNAQTYANDIALVRMAES 131

  Fly   131 -ALLCDSIRPIRLPGLSSSRNSYDY----VPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE 190
             |...:.::||||        :.|:    ..|..|||||....:..:.:.|:::...|..:|||.
Mosquito   132 LAFTGNELQPIRL--------ATDFFETATNATVSGWGRFAISNNQLPNRLQFIRTDVIGSEDCA 188

  Fly   191 YSY-----ANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPS 250
            ..:     :.|....||......:..|.||:|||||....      |:||.|:  ...|..|.|.
Mosquito   189 EQFEEPYRSRISDRTICTSNQANQGVCLGDAGGPLVLDGE------LVGVQSW--SIPCGTGLPD 245

  Fly   251 VFTRITAYLDWI 262
            |:.|::.:..||
Mosquito   246 VYERVSHHRAWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/242 (32%)
AgaP_AGAP003971XP_318423.5 Tryp_SPc 36..257 CDD:214473 78/242 (32%)
Tryp_SPc 37..257 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.