DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and TRY1_ANOGA

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_317170.2 Gene:TRY1_ANOGA / 1277688 VectorBaseID:AGAP008296 Length:274 Species:Anopheles gambiae


Alignment Length:252 Identity:83/252 - (32%)
Similarity:126/252 - (50%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKA--VAITYYL 88
            :.:|.||.||.....:..||||.|...:.::    ||.|::|.:::||||||...|  .::|..|
Mosquito    42 YAVGQRIVGGFEIDVSDAPYQVSLQYNKRHN----CGGSVLSSKWVLTAAHCTAGASPSSLTVRL 102

  Fly    89 GGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYD 153
            |.....:...::|..  .|..||.::..|::.|.:|:.|.::....||::|:.||  .......|
Mosquito   103 GTSRHASGGTVVRVA--RVVQHPKYDSSSIDFDYSLLELEDELTFSDSVQPVGLP--KQDETVKD 163

  Fly   154 YVPAIASGWGRMNDESTAISDN-LRYVYRFVESNEDCEYSYA---NIKPTNICMD-TTGGKSTCT 213
            ......||||  |.:|.|.|:. ||.......:.::|..:|:   .:....:|.. ..|||..|.
Mosquito   164 GTMTTVSGWG--NTQSAAESNAVLRAANVPTVNQKECNKAYSEFGGVTDRMLCAGYQQGGKDACQ 226

  Fly   214 GDSGGPLVYSDPVQNAD-ILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWIGEVSGV 268
            ||||||||       || .|:||.|:|  .||.: |||.|::|:....||:.|.|||
Mosquito   227 GDSGGPLV-------ADGKLVGVVSWG--YGCAQAGYPGVYSRVAVVRDWVRENSGV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/239 (32%)
TRY1_ANOGAXP_317170.2 Tryp_SPc 47..268 CDD:214473 77/239 (32%)
Tryp_SPc 48..271 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.