DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP006539

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_316577.4 Gene:AgaP_AGAP006539 / 1277138 VectorBaseID:AGAP006539 Length:270 Species:Anopheles gambiae


Alignment Length:280 Identity:76/280 - (27%)
Similarity:137/280 - (48%) Gaps:25/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASL 65
            :.||..|:.:.:.:.....:.:|.. |...||..|..|....:|:.:.|........   ||.|:
Mosquito     6 LTISFALLGVALAIPASRSTIVDES-GPDRRIVNGTDASILDYPFMLSLRGSTGGHS---CGGSI 66

  Fly    66 ISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVH------LHPDWNCQSLE-NDIA 123
            :|:.:.:||||||.   :.|.|| ..:::....:.|..:..|:      .||.::.::.. ||||
Mosquito    67 LSELWAMTAAHCVS---STTTYL-QTIQVGRTNISRDVDDSVYGIAQVIAHPQYDSRNSHLNDIA 127

  Fly   124 LVRLPEDALLCDSIRPIRLPG-LSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNE 187
            |::|....:..:|::|:|||. :....:..|.:.....|||.:....:|.: .|:.|..:|..||
Mosquito   128 LLKLQRPIVFSESVQPVRLPAPMFEVEDDLDDLGVTLIGWGLLATGGSAPA-TLQRVDYYVVPNE 191

  Fly   188 DCEYSY-ANIKPTNICMDTT-GGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPS 250
            :|...: ..|.|::||.... |||..|:|||||||::.      .:.:|:.|:..|......||.
Mosquito   192 ECNAIHTGTIYPSHICAAIPGGGKGQCSGDSGGPLLHH------GVQVGIVSWSVKPCAVAPYPG 250

  Fly   251 VFTRITAYLDWIGEVSGVHY 270
            |.|:::.:|::|.:.:|:.|
Mosquito   251 VLTKVSHHLEFIQQHTGITY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/240 (28%)
AgaP_AGAP006539XP_316577.4 Tryp_SPc 35..262 CDD:214473 68/240 (28%)
Tryp_SPc 36..265 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.