DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and SP24D_ANOGA

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_316450.1 Gene:SP24D_ANOGA / 1277027 VectorBaseID:AGAP006416 Length:271 Species:Anopheles gambiae


Alignment Length:253 Identity:80/253 - (31%)
Similarity:115/253 - (45%) Gaps:54/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEK------AVAITYY 87
            |.||.||.:|...|||:||.|.  ..|.:  .||.|||..|::|||||||..      |.:|...
Mosquito    47 GARIVGGSVASEGQFPHQVALL--RGNAL--TCGGSLIESRWVLTAAHCVYNGALVVPASSIVVV 107

  Fly    88 LGGV-----LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVR----LPEDALLCDSIRPIRLP 143
            .|.|     :|.|..::|          |.....:.:||:||::    ||..|.    ||||.|.
Mosquito   108 AGSVSLSNGVRRAVARVI----------PHERYGNFKNDVALLQLQLSLPSSAY----IRPIALR 158

  Fly   144 GLSSSRNSYDYVPA----IASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMD 204
            ..|        |||    :.||||||. :...:|:.|||....|.:::.|..: ..|....||..
Mosquito   159 TTS--------VPAGSEVVISGWGRMY-QGGPVSNMLRYNRATVVADQQCRMA-TGISTGLICFT 213

  Fly   205 TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            :......|.||||||.:.::.      |:||.:: ..:.|....|..:.|::.::.||
Mosquito   214 SPVNNGACNGDSGGPAILNNQ------LVGVANF-IINYCGSASPDGYARVSDFVTWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/249 (31%)
SP24D_ANOGAXP_316450.1 Tryp_SPc 49..264 CDD:214473 77/249 (31%)
Tryp_SPc 50..267 CDD:238113 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.