DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP005707

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_315716.4 Gene:AgaP_AGAP005707 / 1276376 VectorBaseID:AGAP005707 Length:299 Species:Anopheles gambiae


Alignment Length:243 Identity:84/243 - (34%)
Similarity:127/243 - (52%) Gaps:12/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            ||:.|::|.|.|||:.||:.| ..:..:.:|...|||.|::||||.|:..:..:|..||......
Mosquito    61 RISDGQIATATQFPWAVGVLI-SGSSSHSFCSGVLISPRFVLTAAVCISGSNTLTILLGASDMTR 124

  Fly    96 PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIAS 160
            ..:.|..:|  :..||:::.....:|||::.|...|.:.::||||.||..|...|:::...|..:
Mosquito   125 VEEFIGVSN--ILSHPNYSSFFNRDDIAILTLSSPAPIRNTIRPIDLPRWSDVGNNFNNWAATTA 187

  Fly   161 GW---GRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVY 222
            ||   ||..:|...| .||.:....|.||..|..|:..|:.|:||..|..| ..|.||.|||:..
Mosquito   188 GWGNTGRRENEPIPI-PNLHFAVDSVNSNFVCGLSHTFIRDTHICTSTDNG-GPCNGDEGGPVTV 250

  Fly   223 SDPVQNADILIGVTS--YGKKSGCTKGYPSVFTRITAYLDWIGEVSGV 268
            ::  .....|:|:.|  |....||.:|..:|.||||.||.||.:.:.|
Mosquito   251 TE--SGRTFLVGIHSFHYSGLFGCDRGRSAVHTRITEYLGWIQDNTDV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 81/235 (34%)
AgaP_AGAP005707XP_315716.4 Tryp_SPc 61..290 CDD:214473 81/235 (34%)
Tryp_SPc 62..293 CDD:238113 82/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.