DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP005706

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_315714.4 Gene:AgaP_AGAP005706 / 1276374 VectorBaseID:AGAP005706 Length:295 Species:Anopheles gambiae


Alignment Length:243 Identity:86/243 - (35%)
Similarity:130/243 - (53%) Gaps:12/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            |||.|::|...|||:..|:.| ..:..:.:|...|||.|::||||.|:..:..:|..||.....:
Mosquito    56 RIADGQIASPTQFPWAAGVLI-SGSSAHSFCSGVLISRRHVLTAAVCISGSNTLTVLLGASDMKS 119

  Fly    96 PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIAS 160
            ..:.|..:|  :..||:::.....:|||::.|..:|.:.|:|:|:.||..|...|.::...|..:
Mosquito   120 VEEFIGVSN--ILSHPNYSSFFNRDDIAILTLAHEAPIRDTIQPVALPRRSQIGNDFNSWAATTA 182

  Fly   161 GW---GRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVY 222
            ||   ||.::|...|. ||::....|.||..|..|:..|:.|:||..|..| ..|.||.|||:..
Mosquito   183 GWGNSGRRDNEPIPIM-NLQFATDAVTSNFRCGLSHTFIRGTHICTATDNG-GPCNGDEGGPVTV 245

  Fly   223 SDPVQNADILIGVTSYGKKS--GCTKGYPSVFTRITAYLDWIGEVSGV 268
            ::  .....|||:.|:....  ||.:|.|||.||||.|||||.:.|.|
Mosquito   246 TE--SGRTFLIGIHSFHFSGLFGCDRGRPSVHTRITEYLDWIQQNSDV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/235 (35%)
AgaP_AGAP005706XP_315714.4 Tryp_SPc 56..285 CDD:214473 82/235 (35%)
Tryp_SPc 57..288 CDD:238113 83/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.