DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP005310

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_315325.4 Gene:AgaP_AGAP005310 / 1276024 VectorBaseID:AGAP005310 Length:256 Species:Anopheles gambiae


Alignment Length:277 Identity:74/277 - (26%)
Similarity:116/277 - (41%) Gaps:42/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLILVQGRSISCLDMGH-GIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGAS 64
            |..|..:..||.:|        .:.| .:.||:|.|..||..||||||.::::...    .||..
Mosquito     1 MNFSVAVAVLLAVV--------SIAHANVVGRVADGSDARRGQFPYQVAMTLKRQT----VCGGV 53

  Fly    65 LISDRYLLTAAHCVEKAVA------ITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIA 123
            ::.:|:.||||||..|...      :..:.|.....:..:..|...  ||.|..:: ...:.|:|
Mosquito    54 MVHERFFLTAAHCFFKGETPLPLEQLNVFYGSEKLFSNGRYNRVKT--VHFHEQYD-HGTKYDLA 115

  Fly   124 LVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNED 188
            :|.:.....|..:.||:.....:...|    :.|..:|:||...|.. ::..|:|.......:..
Mosquito   116 VVEVKRKFDLTSASRPVEFGQEAFGEN----LLATVTGYGRNTVEGN-MAFRLKYAQLTSLPDSQ 175

  Fly   189 C-----EYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGY 248
            |     |..|..:    .|:||:.|...|.||.|||.|:.|.      |:||.||.....|..|.
Mosquito   176 CREAMGEDYYEGV----FCLDTSAGAGFCLGDYGGPAVFEDR------LVGVGSYTVGGKCEAGL 230

  Fly   249 PSVFTRITAYLDWIGEV 265
            |.||..:..:.:|:..|
Mosquito   231 PDVFVDVGHFSEWVQSV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/241 (27%)
AgaP_AGAP005310XP_315325.4 Tryp_SPc 21..247 CDD:238113 67/247 (27%)
Tryp_SPc 24..244 CDD:214473 65/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.