DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP005065

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_313940.4 Gene:AgaP_AGAP005065 / 1274748 VectorBaseID:AGAP005065 Length:246 Species:Anopheles gambiae


Alignment Length:279 Identity:79/279 - (28%)
Similarity:120/279 - (43%) Gaps:63/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISD 68
            |.::..:|:...|..:|.     .|..||.||:||...|.|||:.|..:..    ..||.|:|.|
Mosquito     6 SVVVGLVLVAFLGTVLSV-----PIWNRIVGGQLAEDTQMPYQIALFYQGS----FRCGGSIIGD 61

  Fly    69 RYLLTAAHCV-EKAVAITYYLGGV------LRLAPRQL-IRSTNPEVHLHPDWNCQSLENDIALV 125
            |::||||||| :..|.:..:..||      |....:.. :|:..|    |..:.  :.::|||::
Mosquito    62 RHVLTAAHCVMDDDVLLPAFKFGVHAGSAHLNAGGKLFKVRAVYP----HEGYG--NFQHDIAVM 120

  Fly   126 RLPEDALLCDSIRPIRLPGLSSSRNSYDYVP----AIASGWGRMNDESTAISDNLRYVYRFVESN 186
            .:.|.......|:||.|..        :.||    .:.||:||:.... .:|..|.|...||..:
Mosquito   121 EMKEPFAFDKYIQPIELMD--------EEVPLGGEVVISGYGRVGSNG-PVSPALLYTSMFVVED 176

  Fly   187 EDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSG-------- 243
            |:|.    :|....:|:|..|....|.||||||.||.               ||.:|        
Mosquito   177 ENCN----SISEGLMCIDKEGSYGACNGDSGGPAVYD---------------GKLAGVANFIIDQ 222

  Fly   244 CTKGYPSVFTRITAYLDWI 262
            |...:...:.:::.|||||
Mosquito   223 CGGNFADGYAKVSFYLDWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/250 (29%)
AgaP_AGAP005065XP_313940.4 Tryp_SPc 28..241 CDD:214473 72/250 (29%)
Tryp_SPc 29..243 CDD:238113 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.