DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP004566

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_313869.5 Gene:AgaP_AGAP004566 / 1274708 VectorBaseID:AGAP004566 Length:327 Species:Anopheles gambiae


Alignment Length:243 Identity:81/243 - (33%)
Similarity:118/243 - (48%) Gaps:21/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV----EKAVAITYYLGGV 91
            ||.||:..:.||:|:...|.....    .:||.||||||::|||||||    ...:::.......
Mosquito    82 RIVGGQETQVNQYPWMAMLQYSGT----FYCGGSLISDRHVLTAAHCVHGFNRNKISVVLMEHDR 142

  Fly    92 LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVP 156
            :..:....:.|....|..|..:|..:..:|||::||.....:.|.:||:.||........||   
Mosquito   143 VSTSESMTMVSKVLRVIEHNGYNSNNYNSDIAILRLATVMTIEDKLRPVCLPTPKKPFTGYD--- 204

  Fly   157 AIASGWGRMNDESTAISDNLRYVYRFVESNEDCE---YSYANIKPTNICMD-TTGGKSTCTGDSG 217
            .|.:||| ...|:.|||.||:.|...:.||.||.   |..:.|....:|.. ..|.|.:|.||||
Mosquito   205 GIVTGWG-ATSENGAISTNLQEVTVPIMSNADCRKTGYGASRITDNMLCAGYDEGKKDSCQGDSG 268

  Fly   218 GPL--VYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWI 262
            |||  :..:...|...:.|:.|:|:  ||.| .||.|:||:..:..||
Mosquito   269 GPLHVIKQNSTDNVHQIAGIVSWGE--GCAKPNYPGVYTRVNRFGTWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 79/241 (33%)
AgaP_AGAP004566XP_313869.5 Tryp_SPc 82..314 CDD:214473 79/241 (33%)
Tryp_SPc 83..317 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.