DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:291 Identity:95/291 - (32%)
Similarity:147/291 - (50%) Gaps:51/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQ--VGLSIEEPN-----DMYCW-CG 62
            :||..|:.:.|    |..: ..:.|.|.||:.|.|::||:.  :|.|..:.:     |.|.| ||
Mosquito     5 LLVVALLWLGG----CFHL-ITVVGAIVGGDSATADEFPHMAVLGRSCLQADGGDCVDGYEWFCG 64

  Fly    63 ASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNP-------EVHLHPDWNCQSLEN 120
            .:|||||::||||||....::   :...|::|....|.|   |       :|.|||.:......|
Mosquito    65 GTLISDRFVLTAAHCAHTGMS---HPPTVVQLGAHDLRR---PALYVGVRDVVLHPGYGGVLAYN 123

  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMN--DESTAISDNLRYVYRFV 183
            ||||:||  ::.:..||:|..   |..|....:.||.||:|||::.  ::.:.|   |:.|...:
Mosquito   124 DIALIRL--ESPVASSIQPAL---LWRSETIPENVPLIATGWGKLGHFEDPSMI---LQRVQIPI 180

  Fly   184 ESNEDC-EYSYAN------IKPTNICM-DTTGGKSTCTGDSGGPLVY----SDPVQNA--DILIG 234
            ..|..| :..|.:      :.|:.:|. |..|||.||.|||||||..    :.|:..|  ..::|
Mosquito   181 VPNSQCNQLLYRSRRLRHGVLPSQLCAGDPNGGKDTCEGDSGGPLQLKLPSARPIGQAYRYYVVG 245

  Fly   235 VTSYGKKSGCTKGYPSVFTRITAYLDWIGEV 265
            :||.|...| |...|.::||:::|..||.:|
Mosquito   246 ITSNGGICG-TVDRPGLYTRVSSYAGWIDQV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 86/261 (33%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 88/263 (33%)
Tryp_SPc 26..272 CDD:214473 86/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.